Web Analysis for Cocktailambassadors - cocktailambassadors.com
Cocktail Ambassadors mixology classes for the beverage industry professional or drinking public. Beverage Program and Cocktail Menu creation, custom cocktails, staff education, Home Mixology and entertainment, skilled event bartenders. H Ehrmann.
2.37
Rating by CuteStat
cocktailambassadors.com is 1 decade 7 years old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, cocktailambassadors.com is SAFE to browse.
PageSpeed Score
80
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | 22 ON 100 |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 12 |
Google Adsense: | Not Applicable | Google Analytics: | UA-4977026-1 |
Websites Hosted on Same IP (i.e. 192.185.108.139)
Trick Photography Ideas
- trickphotographyideas.net
how to do trick photography and special effects review
Not Applicable
$
8.95
Trick Photography And Special Effects 2nd Edition Pdf
- trickphotographyandspecialeffectsreview.net
how to do trick photography and special effects
Not Applicable
$
8.95
Trick Photography
- trickphotographyspecialeffects.org
trick photography techniques how to shoot trick photos
Not Applicable
$
8.95
Trick Photography And Special Effects 2nd Edition Pdf
- trickphotographyandspecialeffectspdf.net
how to do trick photography and special effects
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Server: nginx/1.6.1
Date: Fri, 05 Sep 2014 21:14:54 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Wed, 16 Oct 2013 23:41:18 GMT
Content-Encoding: gzip
Server: nginx/1.6.1
Date: Fri, 05 Sep 2014 21:14:54 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Wed, 16 Oct 2013 23:41:18 GMT
Content-Encoding: gzip
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns1.gropperit.com | 192.185.108.133 | United States of America | |
ns2.gropperit.com | 192.185.108.134 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
cocktailambassadors.com | A | 14399 |
IP: 192.185.108.139 |
cocktailambassadors.com | NS | 21599 |
Target: ns1.gropperit.com |
cocktailambassadors.com | NS | 21599 |
Target: ns2.gropperit.com |
cocktailambassadors.com | SOA | 21599 |
MNAME: ns1.gropperit.com RNAME: gropperit.gmail.com Serial: 2014080800 Refresh: 86400 Retry: 7200 Expire: 3600000 Minimum TTL: 86400 |
cocktailambassadors.com | MX | 14399 |
Target: cocktailambassadors.com |
cocktailambassadors.com | TXT | 14399 |
TXT: v=spf1 +a +mx +ip4:192.185.81.144 +ip4:184.173.239.120 +include:websitewelcome.com +include:gmail.com +include:google.com +include:elixirsf.com -all |
Full WHOIS Lookup
Domain Name: COCKTAILAMBASSADORS.COM
Registry Domain ID: 896862634_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: www.enom.com
Updated Date: 2014-02-24 23:25:00Z
Creation Date: 2007-03-27 21:33:00Z
Registrar Registration Expiration Date: 2015-03-27 21:33:49Z
Registrar: ENOM, INC.
Registrar IANA ID: 48
Registrar Abuse Contact Email: abuse@enom.com
Registrar Abuse Contact Phone: +1.4252744500
Reseller: NAMECHEAP.COM
Domain Status: clientTransferProhibited
Registry Registrant ID:
Registrant Name: WHOISGUARD PROTECTED
Registrant Organization: WHOISGUARD, INC.
Registrant Street: P.O. BOX 0823-03411
Registrant City: PANAMA
Registrant State/Province: PANAMA
Registrant Postal Code: 00000
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext:
Registrant Fax: +51.17057182
Registrant Fax Ext:
Registrant Email: 4FB23E60018A4B36913B2802FD6EE57B.PROTECT@WHOISGUARD.COM
Registry Admin ID:
Admin Name: WHOISGUARD PROTECTED
Admin Organization: WHOISGUARD, INC.
Admin Street: P.O. BOX 0823-03411
Admin City: PANAMA
Admin State/Province: PANAMA
Admin Postal Code: 00000
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: 4FB23E60018A4B36913B2802FD6EE57B.PROTECT@WHOISGUARD.COM
Registry Tech ID:
Tech Name: WHOISGUARD PROTECTED
Tech Organization: WHOISGUARD, INC.
Tech Street: P.O. BOX 0823-03411
Tech City: PANAMA
Tech State/Province: PANAMA
Tech Postal Code: 00000
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: 4FB23E60018A4B36913B2802FD6EE57B.PROTECT@WHOISGUARD.COM
Name Server: NS1.GROPPERIT.COM
Name Server: NS2.GROPPERIT.COM
DNSSEC: unSigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
Last update of WHOIS database: 2014-02-24 23:25:00Z
The data in this whois database is provided to you for information
purposes only, that is, to assist you in obtaining information about or
related to a domain name registration record. We make this information
available \"as is,\" and do not guarantee its accuracy. By submitting a
whois query, you agree that you will use this data only for lawful
purposes and that, under no circumstances will you use this data to: (1)
enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or (2) allow,
enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic
mail, or by telephone. The compilation, repackaging, dissemination or
other use of this data is expressly prohibited without prior written
consent from us.
We reserve the right to modify these terms at any time. By submitting
this query, you agree to abide by these terms.
Version 6.3 4/3/2002
Registry Domain ID: 896862634_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: www.enom.com
Updated Date: 2014-02-24 23:25:00Z
Creation Date: 2007-03-27 21:33:00Z
Registrar Registration Expiration Date: 2015-03-27 21:33:49Z
Registrar: ENOM, INC.
Registrar IANA ID: 48
Registrar Abuse Contact Email: abuse@enom.com
Registrar Abuse Contact Phone: +1.4252744500
Reseller: NAMECHEAP.COM
Domain Status: clientTransferProhibited
Registry Registrant ID:
Registrant Name: WHOISGUARD PROTECTED
Registrant Organization: WHOISGUARD, INC.
Registrant Street: P.O. BOX 0823-03411
Registrant City: PANAMA
Registrant State/Province: PANAMA
Registrant Postal Code: 00000
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext:
Registrant Fax: +51.17057182
Registrant Fax Ext:
Registrant Email: 4FB23E60018A4B36913B2802FD6EE57B.PROTECT@WHOISGUARD.COM
Registry Admin ID:
Admin Name: WHOISGUARD PROTECTED
Admin Organization: WHOISGUARD, INC.
Admin Street: P.O. BOX 0823-03411
Admin City: PANAMA
Admin State/Province: PANAMA
Admin Postal Code: 00000
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: 4FB23E60018A4B36913B2802FD6EE57B.PROTECT@WHOISGUARD.COM
Registry Tech ID:
Tech Name: WHOISGUARD PROTECTED
Tech Organization: WHOISGUARD, INC.
Tech Street: P.O. BOX 0823-03411
Tech City: PANAMA
Tech State/Province: PANAMA
Tech Postal Code: 00000
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: 4FB23E60018A4B36913B2802FD6EE57B.PROTECT@WHOISGUARD.COM
Name Server: NS1.GROPPERIT.COM
Name Server: NS2.GROPPERIT.COM
DNSSEC: unSigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
Last update of WHOIS database: 2014-02-24 23:25:00Z
The data in this whois database is provided to you for information
purposes only, that is, to assist you in obtaining information about or
related to a domain name registration record. We make this information
available \"as is,\" and do not guarantee its accuracy. By submitting a
whois query, you agree that you will use this data only for lawful
purposes and that, under no circumstances will you use this data to: (1)
enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or (2) allow,
enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic
mail, or by telephone. The compilation, repackaging, dissemination or
other use of this data is expressly prohibited without prior written
consent from us.
We reserve the right to modify these terms at any time. By submitting
this query, you agree to abide by these terms.
Version 6.3 4/3/2002